SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI2653 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35128.JGI2653
Domain Number 1 Region: 504-644,679-801
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.15e-36
Family Calponin-homology domain, CH-domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1156-1247
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000119
Family Motor proteins 0.067
Further Details:      
 
Domain Number 3 Region: 1041-1110
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000354
Family Motor proteins 0.045
Further Details:      
 
Domain Number 4 Region: 1302-1398
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000425
Family Motor proteins 0.044
Further Details:      
 
Domain Number 5 Region: 1645-1711
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000478
Family Motor proteins 0.038
Further Details:      
 
Weak hits

Sequence:  35128.JGI2653
Domain Number - Region: 857-947
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000151
Family Motor proteins 0.056
Further Details:      
 
Domain Number - Region: 950-1065
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000558
Family Motor proteins 0.073
Further Details:      
 
Domain Number - Region: 1401-1502
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00876
Family Motor proteins 0.037
Further Details:      
 
Domain Number - Region: 1836-1924
Classification Level Classification E-value
Superfamily ARM repeat 0.0196
Family Armadillo repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI2653
Sequence length 1950
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
MSGIMMNSSSRVHQHSTNTPRPSSAPTPTTSTGRKPLSSFNSNVVVARSNALRPHQPKWQ
RQSSSKSHNKMKPLGASNRSFSTNDLMQQQQQHGSAIKSATKKQQQQPMGSFVYSTPKIK
TSSVRRTSSTANNTKQQQRRSLGSAALSNRRLNLDPLGEAIYCDTNVVGVGYRGRRSNNA
VVEEEGRPSNNLTDFIAGRRAKLAQIGGDLRCNSNNVMVDTSEESGGALMAEYKRQASHW
RRYSSFKSYYHARPVGDATVVLGMMQQSEPKEIAIQPQQQTTTARSSSLTPTDAHWEAKQ
SVAFSNWLNHLFLPTDAQVNHLSDDSNANALLTLLTHQQRSAESKAATVLFTSFEMMETR
DSIEREVGRGRLVLRSDRDILADVQLREGLTELLLSYSSRWLQLGLETVLGLYDGEGRKM
SERLPKKFLKRVIEEMILSEPSTVMKYTGGRCKTPCGKFEKRLRARLQQHALTKMLTLVA
FLDLAKERHLLADDPCLFEKSATVKSSLQVLVSICQNCFARDECIAKHSYLGISVSHVQN
PLDEYEFFIENLAVDLKDGVRLAKMVEILTMTKNVLTEMRLPAVSRDHKIHNVGIVLSAL
HNAGVGNISDVTAAHIVDAHQPRILQLLWSIIVEFQIAAVLDASAICKEIDRLSQLKTRE
NNNGKDSLGLEQLDLTGGTYERIKRLLLVWCQVVCSFHGVSVENFSTSFADGKVLCLLIS
FYLPSILPLQAIRPTVSDLQITTKTGVKIAGYVHKKGNLALAMARMSEVGGIPPLFSASD
FLLPPEEKAIILCLSFLFSRLTVTQQEFVATSFQRRVVASLAFRFTVTLHRASILIQCHV
RRHLASKAVSGMRAKMACLLIQTSWRSSQTSSAYQFVRKGVVSFQSLWRKHVARSSYRST
LTQFVKLQTQWRTHSCLNQYISIRNNVIIVQSAVRRCLVISRLRKIVDASFRERIMFRRY
LRWRKKSGTRSKLESLFHLVESRGAMNLSCVNSNAAVHIQAVYRGLIGRTKMKRMIHAST
QIQRFWRGCQAKISFGFDLMSVIVTQSIVRRFVIRRQIERRHRASTDLQKVWRGYNAKVS
YGFDLMAVVIVQSVARAFIARRSVDQLRKASVSIQRVWRGHQAKVLYGFVLMDVVVTQSF
ARRFITRRRAEERICASSRIQSVLRGYRKKNEYVTDALDIATAQSIARTFICRKQGDSLC
DAAIVIQRVWRGRTSRHKHEAFRLGVITVQSHARCFFARRKSSNMAMAKSHNNAAIGIQR
VWRGHKAKHLHRSVFVALVTMQSRARMLTAKRDRDIKLQSTRKHHAATIIQRCWISKTFR
SKYLQMQQLVRICQAYARRNLAASSFRRQKNCAVVMQRHWRGFCARVQVSISLGAASVIQ
ACIRRDLASTHVSELKERAQSVVKTQSLWKASKTKQLIAMHKAPAVSIQTFARQASATKA
AANQHYLAILIQSSWRRFVAKRQFMKSLRDVVVVQGLERCHHQQVAAVAIQSGFRHWLRR
RQAQHAINIQRNWKGFSVRQEYRRKLQCHARRCIAGRTLSRIKSETSVAEPTPYYDHSLL
SDQEVVSFVSRHAPRRHHVCDEVALRESPNTSRQNSPTLLYEESAVIIQKAWRCYTASIA
LSIIKIAADIIQNTSRRYLVKLKMRRLNDSATTIQRFSRGICTRMHNREETIAATEIQRV
WRGYSVNVEFMLTVLSAIRIQSCARRFLEAKSKVDGSYRREEPGTTASLLTNGSDEMSLY
VVDSSFDGQIELQPDGICSPRFHIDHGVQGVQTRKQLRRSSALQSAQKSNTTQLQPLYPE
HSAQRITTRSTTMTLNLAQSAEALRVLKTSRLLSEVTAAVSTLEITTMQSVDCCKYFTEA
NAHYSFFYLIGSCNRSSPHLELLMSILQTLTNVASHPSTVPPLATVEAVDILTDLVQMFR
DKSRLFALSSSLLERLILSDNTLLVSELFC
Download sequence
Identical sequences B8BUZ6
XP_002287403.1.2071 35128.JGI2653 jgi|Thaps3|2653|fgenesh1_pg.C_chr_2000608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]