SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI267929 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35128.JGI267929
Domain Number 1 Region: 101-175
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 5.1e-17
Family Skp1 dimerisation domain-like 0.00055
Further Details:      
 
Weak hits

Sequence:  35128.JGI267929
Domain Number - Region: 3-126
Classification Level Classification E-value
Superfamily POZ domain 0.00129
Family BTB/POZ domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI267929
Sequence length 196
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
MKTVKLLSQSDEEFYIPLAATRLSEALNAEIECHYDEDDDDHSSTSGAGDECHGSDLTDV
VTVTSAALDKVADFLTHYETVEVMLSFEPPFTSEDIHDIVQQWYADFISVDKILLLDILA
AANFLSIQPLLKLAVLAISVQMNGKSPNELRPMFGISNDLNDPKEKERVRDENQWAFEAR
RQFESKDESRTCNNNE
Download sequence
Identical sequences B8BSW1
jgi|Thaps3|267929|estExt_thaps1_ua_kg.C_chr_10019 XP_002285973.1.2071 35128.JGI267929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]