SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI268598 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35128.JGI268598
Domain Number 1 Region: 146-247
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.68e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI268598
Sequence length 412
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
MSDVIESTASNNNDSTKSSSKKNHNKYRRDKPWDNPSIDHWAITPWDEETNNDSLPGGRL
LEESSFATLFPKYREKYLREVWPLVTKSLDKYKVACELNLVEGSMTVRTTKKTSDPYIIL
KARDLIKLLARSIPAPQALKILNDDHHCEIIKIGGLVRNKERFVKRRQRLIGPDGATLKA
LELLTQCYILVQGNTVSVMGTYKGIKQTRNVILDCMNNIHPVYNIKRLMIMRELERDPKL
KEESWERFLPTFKKKNVKRRKPHQLKKKKSYTPFPPAQQPSKIDLQLESGEYFLSERERK
AKKLGEKKIASMEKTEEKRRARELEFVHPSKFEEASVGGGTAAGAVVEANRKGSESGVDA
KDDVDRLAKKFAKKRKSGGGGDANDGDDAATDMLLGSDKKKRKKDKKRSKSD
Download sequence
Identical sequences B8C0X8
XP_002289146.1.2071 jgi|Thaps3|268598|estExt_thaps1_ua_kg.C_chr_40029 35128.JGI268598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]