SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI32691 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35128.JGI32691
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000412
Family Tetramerization domain of potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI32691
Sequence length 90
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
EFIRIDVGGRVFCVSKSTLADSASYFESLLSDRWAAKEDDSDVFIDQDPDAFEILLTFMR
CGIVHLPKGDLYLSKKALILAEYLGLHGFL
Download sequence
Identical sequences B8BY89
jgi|Thaps3|32691|e_gw1.3.695.1 XP_002288898.1.2071 35128.JGI32691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]