SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI36929 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35128.JGI36929
Domain Number 1 Region: 3-74
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000012
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 217-290
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000145
Family Eukaryotic type KH-domain (KH-domain type I) 0.00032
Further Details:      
 
Domain Number 3 Region: 82-186
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000001
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI36929
Sequence length 296
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
TAIKLLVSNNSSGCIIGRSGKTISELQADSSTRIKLSQGGDYYPGTQDRVCLIQGSLDNA
RVAVEMILLKLLQVESIVNEFGSVAMPFTIQVLVPTPSCGMLIGRGGSNIKSIKEESGVS
FIQLSQKEQDNNHTANAIMSNTAINTAATTSERIITISGCFESCVKCVLLILEEMASNPE
VSRYMNMTTSYSKVVAAQQSAATAQSSHPPSLSAPTHSIQFGIPESMVGFVLGRRGKTLT
QLQEQSQTRIRLSQRGVFLPGTNQRVLTITGNTAEHVANAQYLINQRLSEKGSSRR
Download sequence
Identical sequences B8CAQ0
jgi|Thaps3|36929|e_gw1.12.134.1 35128.JGI36929 XP_002293259.1.2071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]