SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI38460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35128.JGI38460
Domain Number 1 Region: 79-153
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.14e-27
Family Skp1 dimerisation domain-like 0.0000372
Further Details:      
 
Domain Number 2 Region: 1-61
Classification Level Classification E-value
Superfamily POZ domain 1.79e-16
Family BTB/POZ domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI38460
Sequence length 156
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
SKEGDTFPVDIEVARMSELVKGMLEDDADDDEEATEIPLPNVKSTVLKKVIEFCKHHRSE
PMTEIEKPLKSAAMAEVVQKWYADFVNVEQVLLFELILAANYMDIKPLLDLTCATVASMI
KGKTPEEIRKTFNIANDFSPEEEAQVREENKWCEEP
Download sequence
Identical sequences B8CEN5
XP_002294707.1.2071 35128.JGI38460 jgi|Thaps3|38460|e_gw1.20.162.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]