SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35128.JGI9998 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35128.JGI9998
Domain Number 1 Region: 8-92
Classification Level Classification E-value
Superfamily POZ domain 1.26e-20
Family Tetramerization domain of potassium channels 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 35128.JGI9998
Sequence length 191
Comment (Thalassiosira pseudonana CCMP 1335)
Sequence
MPDNNTATVKFNVGGRAFEVSRSLLDKYSDTVLGRTVSETWQEDAEKPVFIDRNGDLFSQ
VLDFMRYGSIELSSATPKSMFDRELDFYGITAEEGSVQHQSLAKVTEEFSCWKSKCDMFR
LALECYHQYGLRSGEVQVRICKDHALFSTDHITEEEREMLCLYLDVYFGLVMPAENSDTF
NRNWFYVCRKE
Download sequence
Identical sequences B8CCW0
jgi|Thaps3|9998|fgenesh1_pg.C_chr_14000343 35128.JGI9998 XP_002293835.1.2071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]