SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 351605.Gura_1252 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  351605.Gura_1252
Domain Number - Region: 43-77
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0129
Family Regulator of G-protein signaling, RGS 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 351605.Gura_1252
Sequence length 93
Comment (Geobacter uraniumreducens Rf4)
Sequence
MRMHNTHKECAVEAKLFNPNAPKKPTNLTINSDLLQKAREHHINLSQTLELRLAELIREE
KRRQWLEENREAIEVYNRRIEADGVFSDGLRRF
Download sequence
Identical sequences A5GAE8
WP_011938174.1.63777 gi|148263323|ref|YP_001230029.1| 351605.Gura_1252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]