SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 351605.Gura_2253 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  351605.Gura_2253
Domain Number - Region: 15-52
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.00445
Family Zn-finger domain of Sec23/24 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351605.Gura_2253
Sequence length 146
Comment (Geobacter uraniumreducens Rf4)
Sequence
MIRRALAAGNEIESMCTKCKVVLNHTIVAMVEGRVVRVKCNTCGSEHNYRPQKTETAASK
RTAAVKTSASARPKTRRDPELADREEWEMLSKSMDMNKAVAYDMNGSFRVNSLVNHPVFG
VGRVSALSENKMEVLFEAGRKLLRCN
Download sequence
Identical sequences A5G3R8
gi|148264303|ref|YP_001231009.1| 351605.Gura_2253 WP_011939132.1.63777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]