SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 351607.Acel_1577 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  351607.Acel_1577
Domain Number - Region: 60-114
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0183
Family F1F0 ATP synthase subunit B, membrane domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 351607.Acel_1577
Sequence length 162
Comment (Acidothermus cellulolyticus 11B)
Sequence
MELTEKLDEIVAHIEGARSVPMSASCIVNRGQLLAMLDELRELLPEELRRAQHILAERDQ
VIAEGRREAERIIEEALRERAQLVAESEIHRAAAEEAERLLDEARREAGEMRREVDDYID
TRLANFEIVLNKTLAAVLRGREKLHGKGELSGLTETTDDPPL
Download sequence
Identical sequences A0LV89
gi|117928784|ref|YP_873335.1| WP_011720412.1.7777 351607.Acel_1577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]