SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 351627.Csac_2064 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351627.Csac_2064
Domain Number 1 Region: 291-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.5e-51
Family Ribonuclease PH domain 1-like 0.00000903
Further Details:      
 
Domain Number 2 Region: 6-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.19e-48
Family Ribonuclease PH domain 1-like 0.0000242
Further Details:      
 
Domain Number 3 Region: 448-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.98e-28
Family Ribonuclease PH domain 2-like 0.0000862
Further Details:      
 
Domain Number 4 Region: 137-230
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.81e-27
Family Ribonuclease PH domain 2-like 0.0022
Further Details:      
 
Domain Number 5 Region: 238-318
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 4.45e-20
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0046
Further Details:      
 
Domain Number 6 Region: 555-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.96e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0051
Further Details:      
 
Domain Number 7 Region: 619-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.57e-18
Family Cold shock DNA-binding domain-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351627.Csac_2064
Sequence length 701
Comment (Caldicellulosiruptor saccharolyticus DSM 8903)
Sequence
MESKIYKMELAGRELSFEIGKYALLANGAVLARYGDTAVLVTACASEKPREGINFFPLTV
DYEERLYSVGKIPGGFIKREGKPSEKAILSARLIDRPIRPLFPKDFYHDVSVIATVLSVD
PDNPPDVLAMLGSSVALSISDIPFEGPTGSVLVGYVDGKIVINPTAKEREVSKLHLVVSG
TKDKVMMIEAGAQEIPEDIMLEAIMTAQEEIKKIVEFIEGIVKEVGKPKMQYEKRVVPEE
IKQKVRELAYEKAYQYVQIPDKIERDKKLDELKEEVLKAFEGETEDTLLLVDDALYNLEK
EIVRKMIAEEGKRPDGRKFDEIRPLYAEVGILPRTHGSALFKRGYTQVLTVATLGTKGEM
QFLDGLEEEEAKRYMHHYNFPPYSTGESKPVRGPGRREIGHGALAERALEPVIPSEDEFP
YTIRLVSEVLTSNGSTSQASVCGSTLALMDAGVPIKAPVAGISIGLITKEDGSFITLTDI
QGIEDFFGDMDFKVAGTREGITAIQLDIKIHGLTKEIIEKALYQAREARLKILDFMQTVI
DKPRSELSPYAPKIFKTTVDPEKIRDIIGPGGKMINKIIAKTNVKIDIEPDGRIFVAAPD
DISGNRAISMIEGIGREIEVGQFFLGKVTRTASYGAFVEIYPGKEGLVHISQLDNKKLKS
VDEVVKVGDLVLVKVIGIDRLGRIALSRKEALNVTYSRKAK
Download sequence
Identical sequences A4XL64
WP_011917584.1.85531 gi|146297069|ref|YP_001180840.1| 351627.Csac_2064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]