SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 351745.Sputw3181_1446 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351745.Sputw3181_1446
Domain Number 1 Region: 33-244
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 4.18e-66
Family Chemotaxis phosphatase CheZ 0.000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 351745.Sputw3181_1446
Sequence length 245
Comment (Shewanella W3-18-1)
Sequence
MKSHTSGLITLEQAQHLVELLSAGEQSQADDLFRELAAPLQRELFDEVGKLTRQLHSALM
DFQVDNRLVQLANTDIPDAKQRLNYVIDMTEQAANKTMDAVEECLPLANALTTNIQQVMP
SWDRLMRRDIALTEFKALCHDVQHLMLRSEQDSDRLRDLLNQILMAQDFQDLTGQMIRRV
IDLVMEVESNLVSMLTVFGEQPIIEHQVIQKNNIEAEGPIMNAELRQDVVTGQDEVDDLL
SSLGF
Download sequence
Identical sequences A4Y8J5 E6XGQ6
319224.Sputcn32_2557 351745.Sputw3181_1446 gi|146293653|ref|YP_001184077.1| gi|120598269|ref|YP_962843.1| WP_011788790.1.65999 WP_011788790.1.82224 WP_011788790.1.85280 WP_011788790.1.98421 gi|386314427|ref|YP_006010592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]