SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 354242.CJJ81176_0888 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  354242.CJJ81176_0888
Domain Number - Region: 44-80
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0645
Family Calponin-homology domain, CH-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 354242.CJJ81176_0888
Sequence length 80
Comment (Campylobacter jejuni 81-176)
Sequence
MNQNNNKTLKNELEDLQYELSIVLEAMLLYAGVKRDKLENAIEAYIDNIDNVLENSNKEG
VDEILEVVEFLKNKYKDFFQ
Download sequence
Identical sequences A0A0H3PHH8 A0A0M3VDZ2
gi|543948067|ref|YP_008540468.1| WP_002857162.1.100331 WP_002857162.1.100400 WP_002857162.1.100542 WP_002857162.1.100676 WP_002857162.1.100792 WP_002857162.1.100887 WP_002857162.1.10286 WP_002857162.1.11028 WP_002857162.1.11659 WP_002857162.1.1234 WP_002857162.1.13569 WP_002857162.1.15640 WP_002857162.1.16820 WP_002857162.1.17095 WP_002857162.1.17262 WP_002857162.1.17852 WP_002857162.1.18181 WP_002857162.1.18202 WP_002857162.1.18253 WP_002857162.1.19018 WP_002857162.1.19041 WP_002857162.1.20589 WP_002857162.1.21419 WP_002857162.1.21928 WP_002857162.1.21976 WP_002857162.1.22220 WP_002857162.1.24806 WP_002857162.1.26207 WP_002857162.1.2792 WP_002857162.1.2850 WP_002857162.1.30212 WP_002857162.1.32103 WP_002857162.1.32806 WP_002857162.1.34057 WP_002857162.1.34552 WP_002857162.1.34555 WP_002857162.1.35241 WP_002857162.1.35260 WP_002857162.1.35631 WP_002857162.1.36032 WP_002857162.1.37489 WP_002857162.1.3757 WP_002857162.1.3944 WP_002857162.1.41270 WP_002857162.1.41380 WP_002857162.1.42301 WP_002857162.1.43217 WP_002857162.1.45383 WP_002857162.1.45819 WP_002857162.1.46068 WP_002857162.1.47446 WP_002857162.1.48803 WP_002857162.1.49088 WP_002857162.1.52711 WP_002857162.1.53101 WP_002857162.1.54360 WP_002857162.1.54592 WP_002857162.1.55240 WP_002857162.1.56219 WP_002857162.1.57411 WP_002857162.1.57958 WP_002857162.1.58320 WP_002857162.1.59192 WP_002857162.1.59555 WP_002857162.1.59911 WP_002857162.1.60399 WP_002857162.1.6051 WP_002857162.1.61283 WP_002857162.1.61951 WP_002857162.1.62545 WP_002857162.1.62886 WP_002857162.1.62922 WP_002857162.1.62948 WP_002857162.1.64056 WP_002857162.1.6406 WP_002857162.1.6508 WP_002857162.1.65190 WP_002857162.1.66520 WP_002857162.1.66802 WP_002857162.1.67955 WP_002857162.1.6862 WP_002857162.1.69353 WP_002857162.1.69737 WP_002857162.1.70203 WP_002857162.1.70788 WP_002857162.1.71045 WP_002857162.1.71813 WP_002857162.1.73951 WP_002857162.1.74061 WP_002857162.1.76967 WP_002857162.1.77380 WP_002857162.1.77454 WP_002857162.1.78159 WP_002857162.1.79396 WP_002857162.1.79449 WP_002857162.1.80425 WP_002857162.1.8102 WP_002857162.1.83522 WP_002857162.1.83548 WP_002857162.1.85725 WP_002857162.1.86318 WP_002857162.1.86557 WP_002857162.1.88975 WP_002857162.1.89296 WP_002857162.1.91489 WP_002857162.1.9176 WP_002857162.1.94694 WP_002857162.1.96265 WP_002857162.1.96363 WP_002857162.1.97347 WP_002857162.1.97629 WP_002857162.1.98782 WP_002857162.1.99003 WP_002857162.1.99717 gi|543946289|ref|YP_008538793.1| gi|121612411|ref|YP_001000556.1| 354242.CJJ81176_0888 gi|543949847|ref|YP_008542191.1| gi|544062509|ref|YP_008562214.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]