SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 355276.LBL_1686 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355276.LBL_1686
Domain Number 1 Region: 27-97
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000942
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 355276.LBL_1686
Sequence length 98
Comment (Leptospira borgpetersenii serovar Hardjo-bovis L550)
Sequence
MSKFKIEGKFGKVTIDTPVIDGYDKIFDEVSKDASTGAISEVEFFLDPVKKITSSGIAKL
LTVKNRMDHYGVKMKIKNLNPDLLEILKKFKVDGKLGF
Download sequence
Identical sequences M6BSN8
gi|116328349|ref|YP_798069.1| 355276.LBL_1686 WP_011670274.1.14 WP_011670274.1.30409 WP_011670274.1.38848 WP_011670274.1.421 WP_011670274.1.48790 WP_011670274.1.51921 WP_011670274.1.55252 WP_011670274.1.75262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]