SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 355277.LBJ_0950 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355277.LBJ_0950
Domain Number 1 Region: 292-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-47
Family Ribonuclease PH domain 1-like 0.0000232
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.67e-42
Family Ribonuclease PH domain 1-like 0.0000776
Further Details:      
 
Domain Number 3 Region: 136-226
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.5e-27
Family Ribonuclease PH domain 2-like 0.0021
Further Details:      
 
Domain Number 4 Region: 449-546
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.23e-23
Family Ribonuclease PH domain 2-like 0.00019
Further Details:      
 
Domain Number 5 Region: 608-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.28e-21
Family Cold shock DNA-binding domain-like 0.0005
Further Details:      
 
Domain Number 6 Region: 237-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.88e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0053
Further Details:      
 
Domain Number 7 Region: 552-629
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000242
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 355277.LBJ_0950
Sequence length 696
Comment (Leptospira borgpetersenii serovar Hardjo-bovis JB197)
Sequence
MTHTISGQYGRDTIVLETGNWAKQAHGAVVYKSGNLVLLATVCAADDAKEGQDFFPLTCE
YTEKLYSVGRFPGGYFKREAKPPEHEILISRIIDRPIRPLFPEGYFCEVQLQVQVLSADG
DVSVAGHALNAASVALTISDIPFNGPIAGARIGRINGELILNPTTKEIVNSDLDLVVAGT
KTHIVMIEGEAKELSNEEMLSALRFAQKHIAEFVTLQEEYAKQIGVVKREVKLKARDVEL
LAKVKEYAFAKLTAANQTPDKTVRNKEISNVNKDVVEFFKQTVEDADKIKDIKTYLHELE
YEIVREQVLNQGVRFDGRRLDEIRPISVEINPLPGPHGSSVFTRGQTQSLGVVTLGTGSD
NQRYETLEGQKEKSFMLHYNFPAFSVGEVRRSSGPGRREIGHGNLAERALKLVLPKSEEF
PYVIRVVSEILESNGSSSMASVCSGSLALMAAGVPIKGSVSGIAMGLFSDSSGKYAVLSD
IAGLEDHFGDMDCKIAGTRKGITAFQMDLKVTGVSFDVLESVFEQAQRGRFHILDIMEKH
ISKASDSLAGTAPRIIVRNIPKDRIGELIGPGGKNVRGISELTGAELYIEDDGRVTISGS
NQESAEKAAKMVDGFFAEVEVGKIYEGKVKRIADFGAFVEILPGKEGLCHISKIDFKRVN
SVKDIVKEGDIIRVKVLNVDKTGKIDLSRKDALEEI
Download sequence
Identical sequences M6W2H4 Q04U27
gi|116330633|ref|YP_800351.1| 355277.LBJ_0950 WP_004281551.1.51494 WP_004281551.1.75198 WP_004281551.1.76100 WP_004281551.1.87468 WP_004281551.1.95176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]