SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 355278.LBF_1476 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355278.LBF_1476
Domain Number 1 Region: 293-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4e-44
Family Ribonuclease PH domain 1-like 0.0000152
Further Details:      
 
Domain Number 2 Region: 9-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.34e-41
Family Ribonuclease PH domain 1-like 0.0000636
Further Details:      
 
Domain Number 3 Region: 143-232
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.29e-28
Family Ribonuclease PH domain 2-like 0.0012
Further Details:      
 
Domain Number 4 Region: 449-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.58e-23
Family Ribonuclease PH domain 2-like 0.00019
Further Details:      
 
Domain Number 5 Region: 605-695
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.11e-21
Family Cold shock DNA-binding domain-like 0.00056
Further Details:      
 
Domain Number 6 Region: 237-320
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000314
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0048
Further Details:      
 
Domain Number 7 Region: 552-628
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000493
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 355278.LBF_1476
Sequence length 696
Comment (Leptospira biflexa serovar Patoc Patoc 1 Ames )
Sequence
MATEFTGVWGRDSITLETGKWAKQAHGSVVYKTGNLVLLATVCAAEEPKEGQDFFPLTCE
YTEKAYSVGRFPGGYFKREAKPAEHEVLLSRILDRPIRPMFPEGYFSEVQLLVQVLSADK
QVSVQGHAINAASAALSVSSIPFAGPIAGARIGRIGGEFILNPTNEEITKSDLDLVVAGT
KDAIVMIEGEASEISKEDMMAALRFAQEQLKFAVAMQEELAKKHGTVKKEVVLKAPDKDL
HAKIREFAFDRLTLANKNADKAKRNDDIKAINKETVEHFKTLLAPEDKTKDIKHFLHELE
YEVVRELVLGEGIRFDGRKTDEIRQISCEIDVLPGPHGSAVFTRGQTQSLGVMTLGTTSD
NQRYETLEGSKEKNFMLHYNFPAFSVGEVRRNSGPGRREIGHGNLAERAIKKVLPTQTEF
PYVIRLVSEILESNGSSSMASVCSGTLALMAGGVPISGAVSGIAMGLFSDEKGRFAVLSD
IAGIEDHFGDMDFKLAGTKKGITAFQMDLKVNGLGLEVLQKAIEQAEVGRDHILGEMNKA
ISSVKGNLSENAPRITQKQIPKDRIGELIGPGGKMIRAIIEQSGSEISVDDSGKVTIASP
SEESKEKAIAMIDGIFEEIEVGKIYDGVIKRIADFGAFVEILPGKEGLCHISKLDVKRVQ
SVRDIVSEGDKIKVKVISVDKMGKIDLSRKDVLLDN
Download sequence
Identical sequences B0SH22 B0SQH8
gi|189911012|ref|YP_001962567.1| gi|183220916|ref|YP_001838912.1| WP_012388515.1.33202 WP_012388515.1.95533 355278.LBF_1476 456481.LEPBI_I1529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]