SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 357804.Ping_0863 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357804.Ping_0863
Domain Number 1 Region: 3-222
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 5.23e-53
Family Glycerol-3-phosphate (1)-acyltransferase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 357804.Ping_0863
Sequence length 231
Comment (Psychromonas ingrahamii 37)
Sequence
MTVYSLFYCLFSPRNPKNTYHFAILFSKLSWLFGLKVTLRIPESAKNNGSVVYLANHQNS
YDMVTVSGAVQPGSVTIGKQSLVWIPFFGIIYWLTGNILISRDNKNKSRNTINEVVDQMR
AKNLAVWIFPEGTRSRGRGLLPFKMGAFHTALQAGVNVVPTVTSNTHKQVNLNRWNNGEV
IVEMLEPIDITQYKKREIRRLMEDSHAIMLEKYQQLNQEVNRPDTNSDRRD
Download sequence
Identical sequences A1ST90
357804.Ping_0863 gi|119944624|ref|YP_942304.1| WP_011769268.1.40834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]