SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 357808.RoseRS_1884 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357808.RoseRS_1884
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily PIN domain-like 0.00000000000000392
Family PIN domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 357808.RoseRS_1884
Sequence length 131
Comment (Roseiflexus RS-1)
Sequence
MLLVDSTIWIDYFNGVASSQTDYLDRILDLKLILVGDLILAEVLQGFRNDTDFERARRAL
EKFRQVSMVNPSLALKSARNFRLLRRKGITVRKTIDSLIATWCIESRVPLLHHDSDFDGY
EAHLGLRVIRP
Download sequence
Identical sequences A5UUH0
gi|148656018|ref|YP_001276223.1| WP_011956619.1.23570 357808.RoseRS_1884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]