SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 357808.RoseRS_2696 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357808.RoseRS_2696
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 4.53e-33
Family Ribosomal L27 protein 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 357808.RoseRS_2696
Sequence length 85
Comment (Roseiflexus RS-1)
Sequence
MAHKKGVGSSRNGRDSNPKMLGVKRFGGERVQPGTIIVRQRGTKIKPGNNVGLGRDYTIY
SLIEGVVTFEQHSRNQKRVSVYATE
Download sequence
Identical sequences A5UWR7
2010240144 gi|148656815|ref|YP_001277020.1| 2015290099 WP_011957414.1.23570 357808.RoseRS_2696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]