SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 357808.RoseRS_3658 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357808.RoseRS_3658
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.1e-30
Family FHA domain 0.00097
Further Details:      
 
Domain Number 2 Region: 123-215
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 8.79e-23
Family PhoB-like 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 357808.RoseRS_3658
Sequence length 220
Comment (Roseiflexus RS-1)
Sequence
MQSGPVPILVIRRQDAATIQIEWDRPILTLGRDPANDIVIDHPLASRRHARLERDESGYL
IRDLDSTNGTYVNGERIEGVQTLHNQDRIWIADAEIVFNDPEATQKGPLPLEILKRVRSH
EEALRVDSRAKEVYIHGKLLDPPLTVKEFQLLELLYTHKGQVLSKDEIARNVWDYEVYDY
NAIDALVYRLRQRIESDPGNPRFVVTVRGFGYKLVTQPDQ
Download sequence
Identical sequences A5UZG0
2014356841 WP_011958355.1.23570 gi|148657758|ref|YP_001277963.1| 357808.RoseRS_3658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]