SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 358681.BBR47_12050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  358681.BBR47_12050
Domain Number 1 Region: 12-116
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.89e-21
Family FHA domain 0.0032
Further Details:      
 
Domain Number 2 Region: 123-226
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 7.37e-17
Family PhoB-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 358681.BBR47_12050
Sequence length 227
Comment (Brevibacillus brevis NBRC 100599)
Sequence
MIDNGAYLLVKKGDPSQVATRKYLTKDRCTIGRRGTSFQLDITFSSPYISRMHAAFQRIG
NDYKIIDLESKHGTEVNGTPLHYSSHILCHGDQISLSKGVAELVFLREVNRLDDTVELPF
TQPKNASLLPGLEIHLERREVRIDGTRLPLTGKDMDLLKLLYQKANKAVSFEEIMLTVWP
ERMLYEGNVPEVGQVEVNALVYRLRKKLRHYGQQITTIPRYGYRLDV
Download sequence
Identical sequences C0Z7D9
WP_012684933.1.45054 358681.BBR47_12050 gi|226310792|ref|YP_002770686.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]