SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 358681.BBR47_29180 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  358681.BBR47_29180
Domain Number - Region: 18-74
Classification Level Classification E-value
Superfamily POZ domain 0.0392
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 358681.BBR47_29180
Sequence length 91
Comment (Brevibacillus brevis NBRC 100599)
Sequence
MDVETAVGLVKERLGIRTAVRDSYLTAIVKGVITELEDEKGVVLVGTNPNHLLFVCDYAT
WRYQSRDSKEAMPRHLQFRLHNLMIHAGGSK
Download sequence
Identical sequences C0Z704
gi|226312505|ref|YP_002772399.1| gi|226314961|ref|YP_002774857.1| 358681.BBR47_29180 358681.BBR47_53760 WP_015891214.1.45054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]