SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 360102.YPA_1299 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360102.YPA_1299
Domain Number 1 Region: 21-133
Classification Level Classification E-value
Superfamily PapD-like 4.45e-32
Family Pilus chaperone 0.0011
Further Details:      
 
Domain Number 2 Region: 137-210
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.00000000262
Family Periplasmic chaperone C-domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 360102.YPA_1299
Sequence length 213
Comment (Yersinia pestis Antiqua)
Sequence
MILIARQIIACSMLLLTSVSLSVQASVVMTGTRIIYPEGSREKVLQLSNKDDHPNLVQLW
MDDGNNQSSPSKSDVPFALTPQIFRMEANSGQVVRLTYIARNLPKNRESVFYLNFLQIPA
LKADTLGEKISVTLDTTTGNKIKVHNPTGYISLRDAKIVSNGKTVSFATSEMFAPDSTTD
LALPIGIKAKKGELLILNVVNDYGATIPNNYYL
Download sequence
Identical sequences A0A0E1NM06
gi|108807295|ref|YP_651211.1| 360102.YPA_1299 WP_002220436.1.12857 WP_002220436.1.65554 WP_002220436.1.7518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]