SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 360105.CCV52592_0953 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360105.CCV52592_0953
Domain Number 1 Region: 320-516
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-44
Family Ribonuclease PH domain 1-like 0.0000665
Further Details:      
 
Domain Number 2 Region: 4-139
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.18e-39
Family Ribonuclease PH domain 1-like 0.00011
Further Details:      
 
Domain Number 3 Region: 479-573
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.82e-24
Family Ribonuclease PH domain 2-like 0.00016
Further Details:      
 
Domain Number 4 Region: 141-257
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.77e-22
Family Ribonuclease PH domain 2-like 0.0041
Further Details:      
 
Domain Number 5 Region: 671-733
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000109
Family Cold shock DNA-binding domain-like 0.0039
Further Details:      
 
Domain Number 6 Region: 584-647
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 360105.CCV52592_0953
Sequence length 735
Comment (Campylobacter curvus 525 92)
Sequence
MQYSIEVNNQVEIFDLNKVAKQAAGAVMLRVKNTVVLATVARDDVQVEEDFLPLTVQYIE
KAYAAGRIPGGYVKRETKPGDFETLTARIIDRSLRPLFPKGYAYPTQIVVMVLSADPEVD
LQVVGLNAASVALYLSDIPVNRPVCGVRVGYIDDKFVINPSNSELKSSALDLYVAGTKDE
LLMIEMRSIAQQSSQIIPIIAIDPMMDPSLNDSITQKQDMNEFSEDRIVEAIDFAGKAIL
RASNAYEEAFKEHKKEDAILELKPEIENENIAIYIDKFYKNDVKNAINQMAKSERASELG
KIAKQIASDEVAQKEGWEEGVISNVLGKYKKKIVREQIINEGVRADGRALDEVRPISIET
NVLPNAHGSCLFTRGQTQALVVATLGTDGDAQMYDILTEKTALIEKFMFNYNFPGFSVGE
ASPLKAPGRRELGHGNLAKRALAPSIDINSPYTIRLVSEILESNGSSSMASVCGGALALR
AAGVDTQKLVAGVAMGLIFEGDKHAVLTDIMGLEDHDGDMDFKVAGSSDGITALQMDIKL
GGISLEVLKEALYQAKRGREHILNLMHQADSKIEVNEDVLPKLELFSVDPSKIVDIIGQA
GKTIKEIIERFEVSIDLDREKGEVKIAGGAKKNVDAAKDYIISITSKENSRGFGKKPHGH
DRRDKDRQKPTFNIGDEFDGVVKSVVDFGAFIELKDGVDGLLHISKIKTPLNVGDRLKVC
VSEQKGNKISLSLVE
Download sequence
Identical sequences A7GX79
gi|154174457|ref|YP_001407821.1| 360105.CCV52592_0953 WP_011992002.1.77152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]