SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 360105.CCV52592_0957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360105.CCV52592_0957
Domain Number 1 Region: 22-97
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 1.7e-19
Family F1F0 ATP synthase subunit C 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 360105.CCV52592_0957
Sequence length 100
Comment (Campylobacter curvus 525 92)
Sequence
MKKIVLLIVSLAAFAFGADGEMIRSYSVIAAGIGLGLAALGGAIGMGNTAAATISGTARN
PGVGSKLMTTMFIALAMIEAQVIYALVITLIVLYANPMLG
Download sequence
Identical sequences A7GX83 J4KU87
WP_009650368.1.33901 WP_009650368.1.37203 WP_009650368.1.77152 gi|154174718|ref|YP_001407825.1| 360105.CCV52592_0957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]