SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 360105.CCV52592_1398 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360105.CCV52592_1398
Domain Number 1 Region: 302-458
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.32e-28
Family HD domain 0.026
Further Details:      
 
Domain Number 2 Region: 194-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000949
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 360105.CCV52592_1398
Sequence length 506
Comment (Campylobacter curvus 525 92)
Sequence
MAGVGAGYLYAKKINDANYNIFLEQAKAKAKAIEYEAELTLKNSKISVQEAEFEAKKRYD
DKTTKLQKEYSQKFDELNKKEQILLNEQELLNENKELFEKDRNEAKLTYEEGLNLKATYQ
SKVQEALKVLEHAAGLTEDEAREVVLKKVEEKSRADIAHIVRKHEEEAKREAKKRVNYIL
AQATSRFAGEFAAERLINVVNIKNDELKGRIIGKEGRNIKTLEMVLGVDIIIDDTPHAII
LSSFNLYRRAIATRVIELLVEDGRIQPARIEDLHKKVTEEFEQSIQEEGENIVIDLGLSK
IHPEITKLIGKLKFRASYGQNALAHSLEVAHLAGIIAAETGGDEKLAKRAGLLHDIGKAL
THEFEGSHVDLGAEICKRYKEHPVVINAIYAHHGHEEATSIESAAVCAADCLSAARPGAR
REVLESFLKRVEEVENIAKSKDGIKQAYAINAGREIRVIANAKLINDDEAVLVAKEIAKE
IEEKVQYPGEIKVSVIRETRAVDYAK
Download sequence
Identical sequences J4V725
360105.CCV52592_1398 gi|154175188|ref|YP_001408115.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]