SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 360106.CFF8240_1241 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360106.CFF8240_1241
Domain Number 1 Region: 471-954
Classification Level Classification E-value
Superfamily ALDH-like 4.45e-96
Family ALDH-like 0.000000479
Further Details:      
 
Domain Number 2 Region: 120-455
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.1e-71
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00038
Further Details:      
 
Weak hits

Sequence:  360106.CFF8240_1241
Domain Number - Region: 1055-1094
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0667
Family Calponin-homology domain, CH-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 360106.CFF8240_1241
Sequence length 1166
Comment (Campylobacter fetus 82-40)
Sequence
MINKTIELASELQNKIVQNISRHEKVFHQKMKKLLLNPQNKVMLIELLDRSFRCKDKKSS
FELIQYTLNKYGIADFFTSYERFLLLAFLNLGKFMPDISVPFFISHLRNETKDMVLDANE
NSLKKHIKLRNEDNITLNINLIGEEVLSEAESLYRIQKYEEAIKSKYITYISIKITTIFS
QINIIDFEYSKKEIVKRLDRLYQLALEEEKISGISKFINLDMEEYRDLELTVEAFMDSIS
KFNIKAGIVLQAYIPDSYHYLQRLFEFSKERVLKGFAPIKIRLVKGANKQSEEAISSQKG
WALPTFDRKIDTDSNYKKMLDFVLSKDNYKFINIGIASHNIFEIAHAYIKIKEAGATESF
SFEMLEGMSIQCSYELSKLHDIILYAPVCSEEHFNNAVAYLVRRLDENSSTDNFMRYFFN
LEVGSREWNTQKELFLKSIDNISNIDNSARRTQDRSVNSHTNSYDEFENEPDTDFILAKN
RKWAQDIKSKFENMQNLEIYPVAKDILKTDDMDSYKVFDKPLNRKIGTVHLANIDQINRA
LKTANESNYSDLSHDEIYKILSKAAEIFRQKRGDLIGIAALEVGKTFLELDPEVSEAIDF
LEFYPHSLKKLKNKYQNIKFTPKGVGVVIAPWNFPIGITTGTIAAPLAAGNRVIYKPSSL
SAITGYKICEYFWEAGVPKDALIFLPAQGALISEHLLTNDSIKFTILTGSEDTAKTILEA
NPCLMLSAETGGKNATIVSKMADKDQAIKNVIHSAFSNSGQKCSATSLLILEEEVYNDNN
FKKSLVEAASSLQIGSPFELKNKLAALASKPSTKLIKAINELKSYEQWALKPQFINDNPH
FMTPAIKYGTKEGDFTHMTELFAPILTVMCAKDLNHALHLANSTGYGLTAGFESLDEREW
EVFHQNIEAGNIYINKPTTGAIVLRQPFGGIKKSAIGFGRKVGIYNYITQFTDITEDGCD
INLKPCDISDKLEKLDIQGYESNILKSLKELSFIAKSYAYHNENEFKTKKDYVNITGEDN
IFSYTKVKNTGYRISKDDSLRDIFAIIIAHEILEIPLYISFEENSNIQIVLKIADALGIA
LNLKQEDLVDFSKKIHEFDRIRYLSKASKNDIVYQKAAKNAKIIANAKPLSNGRFELLYY
HNEKSLSISYHRYGNLGARALQHMKG
Download sequence
Identical sequences A0RQB5
360106.CFF8240_1241 gi|118475684|ref|YP_892398.1| WP_011732134.1.16919 WP_011732134.1.63275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]