SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 360107.CHAB381_0237 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360107.CHAB381_0237
Domain Number 1 Region: 298-495
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-42
Family Ribonuclease PH domain 1-like 0.0000546
Further Details:      
 
Domain Number 2 Region: 5-139
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-39
Family Ribonuclease PH domain 1-like 0.0001
Further Details:      
 
Domain Number 3 Region: 458-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.54e-23
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 4 Region: 141-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.43e-22
Family Ribonuclease PH domain 2-like 0.0036
Further Details:      
 
Domain Number 5 Region: 644-707
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000382
Family Cold shock DNA-binding domain-like 0.0039
Further Details:      
 
Domain Number 6 Region: 562-667
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000804
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 360107.CHAB381_0237
Sequence length 711
Comment (Campylobacter hominis ATCC BAA-381)
Sequence
MKYAVEVNNNVEIFEINKVAKQAAGACLMKVKNTVVLATVARENTQVEEDFLPLTVQYIE
KQYAAGRIPGGYIKRETKPGDFETLTSRIIDRSLRPLFPKGYAYPTQIVVFVLSADPEID
LQVVGLNAASVALYLSDIPMKAPVCGVRVGYINDSFVINPTNSELQNSALDLYVAGVKDE
MLMIEMRSLPNMNGENQNMNEFSEDKMVEAIDFASKAILAGSTAYENTFSALKKPDAALE
YKPEVEDENIANFIEQNFTSDVQAAINQMAKSERATELDKIVNKIMQSETAIQNEWQKNV
VSNIIGKFKRKIIRSQIINERRRADGRALDEIRPISIETNILPNAHGSCLFTRGQTQALV
VTTLGGETDAQVSDSLTSNTPISERFMFQYNFPGFCVGEASPLKSPGRRELGHGNLAKRA
LTPSVPLNNPQVIRTVSEILESNGSSSMASVCGGSLSLRAAGVSTLKLVAGVAMGLIFED
DKHAILTDIMGLEDHDGDMDFKVAGTREGITALQMDIKLGGISLEILREALNQAKDGRNY
ILNLMEVANDDIIINEEILPKIEIFGVDPNKMVDIIGQGGKTIKELIDKYEVSIDLERDS
GEVKIQGANKINVENAKSDILNIVKKSNDFKKGSKFGHHHERKETSNFQVGEEFDGVVKK
IMDFGAFISLKDGIDGLLHVSKIKTQLSEGDTLRVKVEEIKRGKISLELCE
Download sequence
Identical sequences A7I002
WP_012108124.1.87930 360107.CHAB381_0237 gi|154148101|ref|YP_001405843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]