SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 360109.JJD26997_0472 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360109.JJD26997_0472
Domain Number 1 Region: 312-507
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.61e-46
Family Ribonuclease PH domain 1-like 0.0000465
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.47e-37
Family Ribonuclease PH domain 1-like 0.00013
Further Details:      
 
Domain Number 3 Region: 470-564
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.57e-26
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 140-250
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.33e-21
Family Ribonuclease PH domain 2-like 0.0038
Further Details:      
 
Domain Number 5 Region: 575-675
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000497
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 6 Region: 647-714
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000647
Family Cold shock DNA-binding domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 360109.JJD26997_0472
Sequence length 718
Comment (Campylobacter jejuni doylei 269 97)
Sequence
MQYSIEINKNTEIFDIDKVAKQATGVLMRQGKSVVLATVAREEKQVEEDFLPLTVQYIEK
AYAAGKIPGGYVKRETKPSDAETLTARIIDRSLRPLFPKGYAYPTQIVVMVLSADPKVDL
QVMSLNAASVALYLSDIPMKAPVCGVRIGKIDGNFILNPNNEELQNSTLDLYVAGVKDEL
LMIEMRALPDQKENEIFIEAPYADVLTQTTSQNMNELSEDEILEALNLAQKAILNGSNAY
EEAFSKHKKNSQIELKNEIEHPEILAFIENNFQKQIKKAINQMAKSERASELNKIAKEIL
NLEIAKDWSEESILNTLAKVKRKLIREQILNEGKRADGRSLNEVRPISIETNILPNAHGS
CLFTRGQTQALVVATLGGENDAQMIDLLTEKNPISERFMVNYNFPGFSVGEASPIKAPGR
RELGHGNLAKRALYPSVDENYPYVIRLVSEILESNGSSSMATVCGGSLALKAAGVPSLKL
VAGVAMGLIFEDNKYAVLTDIMGLEDHDGDMDFKVAGSKDGITALQMDIKLGGIDQETLK
QALYQAKEGRIHILNIMEEATKEIIVNEEVLPKLELFSVDPSKIVDIIGQAGKTIKEIIE
KFGVSIDLDREKGEVKIAGSQNEQIKAAKDYIINITSSQKGTKKGSKDKDISDFELGQEF
QGIVKKIAPFGAFVELKNGVDGLLHSSKIKHLDLSENQSLKVKISEIKNGKISVDLCE
Download sequence
Identical sequences A7H2C7
WP_011989781.1.67127 360109.JJD26997_0472 gi|153951894|ref|YP_001397657.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]