SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 360109.JJD26997_0520 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360109.JJD26997_0520
Domain Number 1 Region: 305-469
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.85e-28
Family HD domain 0.04
Further Details:      
 
Domain Number 2 Region: 207-301
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000354
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 360109.JJD26997_0520
Sequence length 517
Comment (Campylobacter jejuni doylei 269 97)
Sequence
MIESLIALIAAIVGLGIGYLVAKKINDAKYEIFVEQAKAKAKAIEYEAELILKDAKNSIL
NAELEVKKKYEEKTHKIQKDFNQKLDDLFKKEQKLQQEEEKLKEDKEYLCKSQKHIQDLQ
SDVDKLKNKYQEKLDDVLKILEHSTRLTQNEAKEIILKKVEENSREQIAHIVRKYEEEAK
NEAKRKANFIIAQATSRFAGEFAAERLINVINIKNDELKGRIIGKEGRNVKTLEMVLGVD
IIIDDTPGAIIVSCFNLYRRAIATKVIELLVEDGRIQPARIEEIHEKVCKEFDSAILEEG
EIIVMDLGLNKIHPEIVKLIGKLKYRASYGQNALAHSLEVAHLAGIIAAECGGDENLARR
AGILHDIGKALTHDFEGSHVDLGAELCNRYKEHPVVINAIYAHHGHEEATSIESAAVCAA
DTLSAARPGARREVLEAFLKRVSELEDIAKSKEGIKNAYAINAGREIRIIANAQLVNDDE
SVLLAKEIAAEIQEKMQYPGEIKVNVIRELRAIEYAK
Download sequence
Identical sequences A7H2G9
gi|153951414|ref|YP_001397699.1| WP_011989818.1.67127 360109.JJD26997_0520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]