SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 360911.EAT1b_0428 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360911.EAT1b_0428
Domain Number 1 Region: 316-467
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.48e-29
Family HD domain 0.018
Further Details:      
 
Domain Number 2 Region: 208-304
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.41e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 360911.EAT1b_0428
Sequence length 520
Comment (Exiguobacterium AT1b)
Sequence
MMEWLYWLILILLLPIAFVAGFFVRKSIAEAKIQGAETEATKIVEQAKQQSEAMQKEARL
EVKEEMIQLRNETEQELRERREEQKVKENRLVQKEELLDRKADMLERKEDSLDEQERGLE
KRKREAEMLESKVEELYEEARQELVRVASLSKDEARTIIMDEAKQEALHDAALLQKEIEQ
KAKQEADKKAKHLLSLTMQRYAAEHVAETTVSVVNLPSDEMKGRIIGREGRNIRTLETLT
GIDLIIDDTPEAVILSGFDPVRREIAKMTLEKLVQDGRIHPARIEEMVEKSRREVDERIR
EYGEEATFEAGIHGLHPDLVKTLGRMRYRTSYGQNVLSHSVEVAHLAGMMAAELGEDVTL
AKRAGLLHDIGKAIDHEVEGSHVEIGVELATKYKEHPVVINSIASHHGDVEATSTIAVLV
AAADALSAARPGARQETLESYIRRLERLESICESFEGVEKSYAIQAGREVRIIVRPDVVD
DVVAGKMARDICKRIEDELDYPGQIKVTVIRETRSVDYAK
Download sequence
Identical sequences C4L2V2
gi|229916159|ref|YP_002884805.1| 360911.EAT1b_0428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]