SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 361100.BCQ_0302 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  361100.BCQ_0302
Domain Number 1 Region: 332-498
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.27e-32
Family Histidine kinase 0.0008
Further Details:      
 
Domain Number 2 Region: 259-343
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.89e-18
Family Homodimeric domain of signal transducing histidine kinase 0.001
Further Details:      
 
Domain Number 3 Region: 221-266
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000222
Family HAMP domain 0.0091
Further Details:      
 
Weak hits

Sequence:  361100.BCQ_0302
Domain Number - Region: 76-130
Classification Level Classification E-value
Superfamily FlaG-like 0.0732
Family FlaG-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 361100.BCQ_0302
Sequence length 501
Comment (Bacillus cereus Q1)
Sequence
MKKIFNPFTYIRKTRQLIEKLVKSVRKSIRIQLITTFAACALLGVFFAKGAAPFFENANR
QATVDYRSGMQQINYQAQRAANSSVHENKLEAISNMIETENQNLERGNRALKILVTDESG
KVVYKTKQAQEEQIDLHNTIRNAASFAINYSNGQDIFENTRKEFIAFSPITIENKNLYMF
VSGIPDGVVMYDTQEGPFPFLIGVLVFIFSFFYITKRKMKQIEAMAEGVKEIEKGNLAYR
IEKKGEDEIASLTENINNMAEELMNNIEKERKLEKQKNELITNVSHDLRTPLTSIMGYLR
LLRDSKYENKEQHDEYTRIAFAKSEQLKNLIEDLFEYTKLTNEQVVLEKQEVCVNELLEQ
LIEELVPQAEEHGLTFVKKFPEERAYAAIDSEKMVRVFDNLLMNAIKYSKDDGEIKVSLQ
RQRRDIQIVIANHSEAFTREELASLFERFYKKDQSRSRVTEGSGLGLAIAKSIVELQGGS
IRAEYEDGIIQFIVSLPIIEK
Download sequence
Identical sequences B9J1H6
WP_000719228.1.10762 WP_000719228.1.13024 WP_000719228.1.20687 WP_000719228.1.24184 WP_000719228.1.29209 WP_000719228.1.33045 WP_000719228.1.3318 WP_000719228.1.3615 WP_000719228.1.37093 WP_000719228.1.37990 WP_000719228.1.44463 WP_000719228.1.49428 WP_000719228.1.50316 WP_000719228.1.50514 WP_000719228.1.54775 WP_000719228.1.54782 WP_000719228.1.56055 WP_000719228.1.57203 WP_000719228.1.57815 WP_000719228.1.57859 WP_000719228.1.58814 WP_000719228.1.60274 WP_000719228.1.64377 WP_000719228.1.70645 WP_000719228.1.77690 WP_000719228.1.81088 WP_000719228.1.82533 WP_000719228.1.84337 WP_000719228.1.93932 WP_000719228.1.95457 WP_000719228.1.95484 gi|222094029|ref|YP_002528081.1| 361100.BCQ_0302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]