SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 361100.BCQ_3592 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  361100.BCQ_3592
Domain Number 1 Region: 8-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.83e-50
Family Ribonuclease PH domain 1-like 0.000018
Further Details:      
 
Domain Number 2 Region: 293-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-48
Family Ribonuclease PH domain 1-like 0.0000135
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.81e-30
Family Ribonuclease PH domain 2-like 0.0023
Further Details:      
 
Domain Number 4 Region: 451-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.4e-29
Family Ribonuclease PH domain 2-like 0.0000843
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.93e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 6 Region: 621-704
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.38e-22
Family Cold shock DNA-binding domain-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 361100.BCQ_3592
Sequence length 712
Comment (Bacillus cereus Q1)
Sequence
MSQEKQVFSIDLAGRQLTVETGQLAKQANGAVLVRYGDTAVLSTATASKEAKNVDFFPLT
VNYEERLYAVGKIPGGFIKREGRPSEKAILASRLIDRPIRPLFADGFRNEVQVVSIVMSV
DQDCSSEMAAMLGSSLALSISDIPFEGPIAGATVGRINGEFVINPTVEQQEQSDIHLVVA
GTKDAINMVEAGADQVPEETMLEAIMFGHDEIKRLIAFQEEIVQAVGKEKSEVKLYEVDA
DLNQAVREMAEKDMHSAIQVHEKHAREDAINEVKKRVIEHYEAQEADADTLGQVNEILYK
IVKEEVRRLITVEKIRPDGRKGDEIRPLASEVGILSRTHGSGLFTRGQTQALSICTLGAL
GDVQILDGLGVEESKRFMHHYNFPSFSVGETRPMRGPGRREIGHGALGERALEPVIPSEK
DFPYTVRLVSEVLESNGSTSQASICGSTLAMMDAGVPLKAPVAGIAMGLVKSGEHYTILT
DIQGMEDHLGDMDFKVAGTAHGVTALQMDIKIDGLSREILEEALQQAKVGRMHILDHMLS
VIAEPRTELSAYAPKIITMTINPDKIRDVIGPSGKQINKIIEETGVKIDIEQDGTVFISS
INQEMNDKAKKIIEDIVREVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERV
GKVEDVVKIGDVITVKVIEIDKQGRVNLSRKVLLKEEQEKEAAKEENKQEQQ
Download sequence
Identical sequences A0A0T8XWK2 A0A1J9YH94 A0A1T2P5D3 A0A229MRM8 A0A243I2Y5 A0A243NQQ3 A0A2C3GVX4 A0A2K1S3N8 B7HLE0 B9IV96 C2MPD7 C2S7K4 F0PQI7 J8G6N1 J8GTA0
gi|375285729|ref|YP_005106168.1| WP_000076746.1.100241 WP_000076746.1.100684 WP_000076746.1.10069 WP_000076746.1.100873 WP_000076746.1.101309 WP_000076746.1.101843 WP_000076746.1.10762 WP_000076746.1.11044 WP_000076746.1.12751 WP_000076746.1.13024 WP_000076746.1.13299 WP_000076746.1.16199 WP_000076746.1.17408 WP_000076746.1.17899 WP_000076746.1.17927 WP_000076746.1.18840 WP_000076746.1.20687 WP_000076746.1.21172 WP_000076746.1.21643 WP_000076746.1.23100 WP_000076746.1.24184 WP_000076746.1.24377 WP_000076746.1.24709 WP_000076746.1.26499 WP_000076746.1.27334 WP_000076746.1.29209 WP_000076746.1.31685 WP_000076746.1.32522 WP_000076746.1.33045 WP_000076746.1.33061 WP_000076746.1.3318 WP_000076746.1.3615 WP_000076746.1.37093 WP_000076746.1.37990 WP_000076746.1.38425 WP_000076746.1.41976 WP_000076746.1.43533 WP_000076746.1.43762 WP_000076746.1.44463 WP_000076746.1.46244 WP_000076746.1.46746 WP_000076746.1.46864 WP_000076746.1.47097 WP_000076746.1.47441 WP_000076746.1.48010 WP_000076746.1.48164 WP_000076746.1.48311 WP_000076746.1.48599 WP_000076746.1.49428 WP_000076746.1.50316 WP_000076746.1.50514 WP_000076746.1.51087 WP_000076746.1.52756 WP_000076746.1.54775 WP_000076746.1.54782 WP_000076746.1.55057 WP_000076746.1.56055 WP_000076746.1.5628 WP_000076746.1.57203 WP_000076746.1.57245 WP_000076746.1.57565 WP_000076746.1.57815 WP_000076746.1.57859 WP_000076746.1.58037 WP_000076746.1.58328 WP_000076746.1.58814 WP_000076746.1.59773 WP_000076746.1.60274 WP_000076746.1.61231 WP_000076746.1.64377 WP_000076746.1.6753 WP_000076746.1.70645 WP_000076746.1.72514 WP_000076746.1.77576 WP_000076746.1.77690 WP_000076746.1.79250 WP_000076746.1.79252 WP_000076746.1.79658 WP_000076746.1.79687 WP_000076746.1.80955 WP_000076746.1.80964 WP_000076746.1.81088 WP_000076746.1.82421 WP_000076746.1.82533 WP_000076746.1.82986 WP_000076746.1.83070 WP_000076746.1.84337 WP_000076746.1.8450 WP_000076746.1.87627 WP_000076746.1.8923 WP_000076746.1.89675 WP_000076746.1.91404 WP_000076746.1.91615 WP_000076746.1.93932 WP_000076746.1.95457 WP_000076746.1.95484 WP_000076746.1.95786 WP_000076746.1.99266 361100.BCQ_3592 405534.BCAH187_A3854 gi|217961227|ref|YP_002339795.1| gi|384181617|ref|YP_005567379.1| gi|222097252|ref|YP_002531309.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]