SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 362242.MUL_3621 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  362242.MUL_3621
Domain Number 1 Region: 122-301
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.23e-40
Family Tandem AAA-ATPase domain 0.049
Further Details:      
 
Domain Number 2 Region: 18-82
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 362242.MUL_3621
Sequence length 352
Comment (Mycobacterium ulcerans Agy99)
Sequence
MTPRETRAADAVGARPADPQVRSSIDVPPDLVVGLLGSADENLRALERTLTASLHVRGNT
VTLAGEPADVAIAERAVSELVAIVANGQPLTPEVVRHSVAMLVGAGNESPAEVLTLDILS
RRGKTIRPKTLNQKRYVDAIDANTIVFGIGPAGTGKTYLAMAKAVHALQTKQVNRIILTR
PAVEAGERLGFLPGTLSEKIDPYLRPLYDALYDMMDPELIAKLMSAGVIEVAPLAYMRGR
TLNDAFIVLDEAQNTTAEQMKMFLTRLGFGSKVVVTGDVTQVDLPGGARSGLRAAVDILD
DIDDIHIAELNSADVVRHRLVSEIVDAYARYEEPGSGMNRAARRASGTRNRR
Download sequence
Identical sequences A0PTT7
WP_011741361.1.20315 362242.MUL_3621 gi|118618895|ref|YP_907227.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]