SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 362663.ECP_3252 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  362663.ECP_3252
Domain Number 1 Region: 21-167
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-50
Family Ribonuclease PH domain 1-like 0.0000141
Further Details:      
 
Domain Number 2 Region: 324-515
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.89e-46
Family Ribonuclease PH domain 1-like 0.0000178
Further Details:      
 
Domain Number 3 Region: 168-258
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-31
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 473-571
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.82e-27
Family Ribonuclease PH domain 2-like 0.0000875
Further Details:      
 
Domain Number 5 Region: 249-348
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.2e-25
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0012
Further Details:      
 
Domain Number 6 Region: 631-716
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.42e-23
Family Cold shock DNA-binding domain-like 0.0000242
Further Details:      
 
Domain Number 7 Region: 577-645
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.37e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 362663.ECP_3252
Sequence length 734
Comment (Escherichia coli 536)
Sequence
MRRRSGINTSTVRYCLRKRKDITLLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDD
TAVFVTVVGQKKAKPGQDFFPLTVNYQERTYAAGRIPGSFFRREGRPSEGETLIARLIDR
PIRPLFPEGFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYI
NDQYVLNPTQDELKESKLDLVVAGTEAAVLMVESEAELLSEDQMLGAVVFGHEQQQVVIQ
NINELVKEAGKPRWDWQPEPVNEALNARVAALAEARLSDAYRITDKQERYAQVDVIKSET
IATLLAEDETLDENELGEILHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRT
HGSALFTRGETQALVTATLGTARDAQVLDELMGERTDTFLFHYNFPPYSVGETGMVGSPK
RREIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPI
KAAVAGIAMGLVKEGDNYVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKE
IMQVALNQAKGARLHILGVMEQAINAPRGDISEFAPRIHTIKINPDKIKDVIGKGGSVIR
ALTEETGTTIEIEDDGTVKIAATDGEKAKHAIRRIEEITAEIEVGRVYNGKVTRIVDFGA
FVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEATEQSQ
PAAAPEAPAAEQGE
Download sequence
Identical sequences A0A0H3ELX4 A0A1X3K738 F4TJK9 U9XV67 V0VQH7
gi|218560236|ref|YP_002393149.1| gi|387618462|ref|YP_006121484.1| gi|386640768|ref|YP_006107566.1| gi|218691456|ref|YP_002399668.1| gi|117625460|ref|YP_858783.1| YP_006121484.1.29421 gi|110643405|ref|YP_671135.1| 362663.ECP_3252 405955.APECO1_3266 585035.ECS88_3548 585397.ECED1_3824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]