SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 362948.LSL_1129 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  362948.LSL_1129
Domain Number 1 Region: 321-471
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.59e-30
Family HD domain 0.017
Further Details:      
 
Domain Number 2 Region: 209-303
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.32e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 362948.LSL_1129
Sequence length 521
Comment (Lactobacillus salivarius UCC118)
Sequence
MIIAITILAIAIATLVIGFALGVAYRKRSYEQALDVATQTATGIIETAKKEAAASKKEAI
IEAKEENHRYRSEIESELKERRSEIQRQENRLLQREEILDRKDTALDKREDVLEKKEAQL
DSDQKVVTKQKEQASLLVKEQQDKLEEIAALTRPEAKELILNETKEELIHERAVMIKESE
EETKATVDRKAKSLIAQAIQRSAADMVSETTVSVVNLPNDEMKGRIIGREGRNIRTLETL
TGIDLIIDDTPEAVVLSGFDPVRREIAKMALERLIQDGRIHPARIEEMVDKATKDMDAKI
REIGEEVIFDLGIHSMHPDLIKTIGRLNYRTSYGQNVLNHSIEVAKISGILAAELGEDVI
LAKRAGLLHDIGKAVDHEIEGSHVELGVELTKKYNESETVVNTIASHHGDTEPKSVIAVL
VAAADAISAARPGARSESLENYIHRLEKLEDISNEFKGVQKSYAIQAGREVRVIVQPNEV
SDLEATVLARDIRMKIEDELEYPGHIKVTVIRETRAVEYAK
Download sequence
Identical sequences Q1WT14
362948.LSL_1129 WP_011476179.1.7912 YP_536020.1.8253 gi|90962104|ref|YP_536020.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]