SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 364106.UTI89_C4512 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  364106.UTI89_C4512
Domain Number - Region: 14-85
Classification Level Classification E-value
Superfamily t-snare proteins 0.000361
Family t-snare proteins 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 364106.UTI89_C4512
Sequence length 87
Comment (Escherichia coli UTI89)
Sequence
MQFRRGMTMSLEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQNAQHQREELE
RENNHLKEQQNGWQERLQALLGRMEEV
Download sequence
Identical sequences A0A090NCQ7 A0A0A7A0W3 A0A192CEZ0 F4NQK1 W8ZZZ0
199310.c4880 364106.UTI89_C4512 gi|386636815|ref|YP_006156534.1| gi|560159734|ref|YP_008852449.1| gi|91213469|ref|YP_543455.1| gi|386631895|ref|YP_006151615.1| gi|26250694|ref|NP_756734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]