SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 365044.Pnap_2207 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  365044.Pnap_2207
Domain Number 1 Region: 24-157
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-41
Family FAS1 domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 365044.Pnap_2207
Sequence length 160
Comment (Polaromonas naphthalenivorans CJ2)
Sequence
MLKRHFIFVLTAVAILSGCASTSLPVSVADTVAAQPQLSTLNGLVVKAGLTDTLKGTGPF
TVFAPTNEAFAKVPAKTMQALASDPAKLKAVLTYHVIPGKVMLADVKNGNSKTVNGANLA
LSRAGDFVTVEEALVQTPDIAASNGVVHVVDSVLLPPASR
Download sequence
Identical sequences A1VPD7
WP_011801593.1.22642 365044.Pnap_2207 gi|121605107|ref|YP_982436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]