SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 365044.Pnap_3576 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  365044.Pnap_3576
Domain Number 1 Region: 33-202
Classification Level Classification E-value
Superfamily C-type lectin-like 4.28e-25
Family Endostatin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 365044.Pnap_3576
Sequence length 223
Comment (Polaromonas naphthalenivorans CJ2)
Sequence
MQSRLRLALLASAAILGACAPMPSTSPHPMSPMSFFVTSANPGKGADLGGLAGADAYCQT
LAASANAGGKNWRAYLSAPASGASPAVNARERIGRGPWQNARGVVVATSVDNLHSADNQL
TKQNSLTEKGEVVSGRGDAVNMHDMLTGSTADGRLDTSAPDTTCGGWTQSGAGSAIVGHH
DRIGINESAPMKSWNASHATPGCSPEALKSVGGAGLFYCFAAN
Download sequence
Identical sequences A1VT94
WP_011802942.1.22642 gi|121606464|ref|YP_983793.1| 365044.Pnap_3576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]