SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00000888 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00000888
Domain Number 1 Region: 74-141
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000000366
Family SNARE fusion complex 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00000888
Sequence length 170
Comment (Neosartorya fischeri)
Sequence
MSSRFPRSSLHQRDPRASSSLFDSYGGGSRPASRSPASVGGYSYGGYSASNADGYMNGGS
TGGFRKATPNAKGQYSDAVLDHLESQNDAQVEGISAKVKMLKDLTLAIGDEIRDTSTISE
LNDAFDNTRVRLRGNMTRMLRMAERTGVGWRAWLGFFLAVFLIFAYVWLT
Download sequence
Identical sequences A1D3N9
XP_001264929.1.95823 36630.CADNFIAP00000888 NFIA_017330||SNARE

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]