SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00003377 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00003377
Domain Number 1 Region: 269-348
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.64e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00079
Further Details:      
 
Domain Number 2 Region: 120-202
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.26e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 3 Region: 37-108
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000269
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00003377
Sequence length 360
Comment (Neosartorya fischeri)
Sequence
MDSTEMRDAPPVDETMADAMNVADEGDMEITPKTEEEYAQSMLTLRAIVSSKEAGVIIGK
AGKNVADLRDETGVKAGVSKVVPGVHDRVLTVTGPLQGTARAYALVAKGLLEGAPQMGMG
GIVNNNGTHPVRLLISHNQMGTIIGRQGLKIKHIQDASGVRMVAQKEMLPQSTERIVEVQ
GTPEGIEKAVWEIGKCLIDDWQRGTGTILYNPAVRASVGGSTSMNTSSVGNGYNSRPYNR
TGNGADFSDGQSGGYGRRSNPDTSNRGYPLVTEDGEEIQTQNISIPADMVGCIIGRGGSK
ITEIRRSSGARISIAKAPHDETGERMFTIMGSAQANEKALYLLYENLEAEKTRRSQLPQE
Download sequence
Identical sequences A1CYX9
XP_001265846.1.95823 36630.CADNFIAP00003377 NFIA_035170||KH

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]