SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00004345 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00004345
Domain Number 1 Region: 165-259
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.67e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00004345
Sequence length 260
Comment (Neosartorya fischeri)
Sequence
MTAPTALLRKSDEPLSAEEPSLAFSSERDDEILIDAQASGQGEAPSLIPTESAQDSDMRI
DEESRPVFTPIADAGTVLRVETRKVPVPPHRMTPLKANWPKIYPPLVEHLKLQVRMNIKN
RAVELRTSKFTTDTGALQKGEDFVKAFTLGFDVDDAIALLRLDDLYIRSFEIRDVKASLN
GEHLSRAIGRIAGKDGKTKFAIENASRTRVVLQGTKVTILGRFRDLGIAQEAIVSLILGS
PPGKVYGNLRKVASRMKERF
Download sequence
Identical sequences A1DM41
XP_001257759.1.95823 NFIA_052070||rRNA 36630.CADNFIAP00004345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]