SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00005341 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00005341
Domain Number 1 Region: 10-103
Classification Level Classification E-value
Superfamily POZ domain 6.28e-33
Family BTB/POZ domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00005341
Sequence length 104
Comment (Neosartorya fischeri)
Sequence
MASSSSTPSEYVTLVSGDGFEFIIPRSAACVSGTIRRMLEPSSKFSEAITGRCVLENLSG
VVLEKVCEYFCYNEKNKNQTNVPDMDIPPELCLELLMAADYLDT
Download sequence
Identical sequences A1DNB1
NFIA_056310||transcriptional XP_001258179.1.95823 36630.CADNFIAP00005341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]