SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00005623 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00005623
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.97e-21
Family Calponin-homology domain, CH-domain 0.00024
Further Details:      
 
Domain Number 2 Region: 122-189
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.57e-16
Family EB1 dimerisation domain-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00005623
Sequence length 203
Comment (Neosartorya fischeri)
Sequence
MSRVKFNVNTEYAYLQNFKILQNTFTRHQIEKPIPVQQLSKCRMQDNLEFLQWTKRYWDQ
HYPGGDYDAVGRRKGSGAPAPSATGTRSGASSSAGATRRGATPTTGAVRPRVSAAAGGAS
TAALQQEIATQKEAIAGLEKERDFYFAKLRDIELLLQNAIEADPELEKEEDSLVKHIQGI
LYSTEEGFEIPAEAEVADELETF
Download sequence
Identical sequences A1D6N8
NFIA_065460||EB1 36630.CADNFIAP00005623 XP_001263279.1.95823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]