SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00006098 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00006098
Domain Number 1 Region: 11-93
Classification Level Classification E-value
Superfamily HMG-box 1.57e-29
Family HMG-box 0.0000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00006098
Sequence length 104
Comment (Neosartorya fischeri)
Sequence
MPKEKTSTRTKTKRVERKKKDPNAPKRGLSAYMFFANENRDKVREENPGISFGQVGKMLG
ERWKALSDTDRRPYEEKAAADKKRYEDEKASYNAAQDEDEEESS
Download sequence
Identical sequences A1D6R2
36630.CADNFIAP00006098 NFIA_065700||nucleosome XP_001263303.1.95823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]