SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00006691 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00006691
Domain Number 1 Region: 1036-1118
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.09e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 888-993
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000105
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 3 Region: 199-296
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000115
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 4 Region: 1239-1301
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 5 Region: 713-787
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000687
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 6 Region: 780-880
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 7 Region: 397-465
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000351
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 8 Region: 307-403
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000114
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00006691
Sequence length 1309
Comment (Neosartorya fischeri)
Sequence
MASQVQSSDVNGGAKSLAAMLEEEHARNEAHKVTVEDTVDEEDLLHPPPSLGKDQQTVPA
QPAAAVEEAVAATPSTSNAAPKRSPAFDVRSEELFPALGSGPKPRAPAAATWGARPSAAA
ALANGAAGRPQATASDVPRIMSLPGKHMEQLRLAPSQMMPRAQLKKPLKDILRDISRRSK
ATVDMRGGPGGSIIFEGKGSVESVRQALKEVAQQVGSKQSVRIPIPTSARAHIIGRQGAI
VQDIQQRTGARVQVPRADDSAAKDDEDDNDTIDVLIEGDAVAAEMARREIEAIVKERASN
MSLRLKSIPAEFFPFIAGAHNANLKAIEERTKAQVHVPRYDTWQSQPPPQEAEPGRVQFV
PASDKHIQITGERTAAQEARAEIERLAADLQRRLTLRQLAINRGQHQFILGDGANALHDF
LADTGCAIVLPPASDDSEFLTITGPQDCIEAGINRAMELATSMQMASIDLSRQHPNAPAG
PHAHARALTRYLQQRQIIRQLEQMYDARIALPPSADGPVTWEVYSRDGKNTIRARSDIMN
LVQAHPPARLRYVSVDPYYHPYLESHGLGKLRNDYGVHLLVPDELDSSDVVLVYEGPSAA
NSLPEIPRQRPSPAEVAAFEKSLQEAQDFLTQLLGDQNDIVAKSVKVPAKYQEKVRKFIA
REQQAKGDDQIPVRALVGDARNDKCDVSLRGPSRQVDELVSKLQDFVVGQEKDDLERGYT
ISFDFPQKFANFLIGKRGENINKLREEFDVDIKVDNGKVEVKGPKAKADAAKARIINLGK
KLEDETTHVLKIPAQYHRELIGQKGSQVNRLQDRYSVRVQFPRAAVATPSFDDQSVADTS
SEVGGSRPIRPNQAPDEVIVKGPSKGADAARDEILSLLQWVIDHSHSATVSVAQSQIPSL
IGQRGREMDKLRADTGAQIDVPGANDAPDASGRVQIKIKGTKQQVEEAKKILLQRSSEFD
AIVTKTIDVDKKHHKALIGGGGANIRKIVTEAGGPSDGSASRIVRFPRPDSSESTIKLEG
NGKVVENIIAAIEAFVKEREDQVTVTVDIPPAQHRLLIGRGGETRRGIESQFNVTLDIPK
QGSGRSDIKLKGPSNAVEGAKEHILAMLKDQQGETVEVPRHLHHAIADNGAFFRRLRNDY
RVTVDHAGQQVPPKPASEESRATTNGASSLPLITDEPSDSVEAHSWKIVDHSAAAPDPTQ
PATIPWVLIGSSDNVARAKSALEKAIASASQQTATGYLILPDPKTYRFVIGQGGSQINAI
RKQTGCRINVPKDQARGEAIEIKGSKEGLEKAKEMILDAVRAGLNGGSR
Download sequence
Identical sequences A1DFP2
36630.CADNFIAP00006691 NFIA_081430||RNA XP_001260096.1.95823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]