SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00006750 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00006750
Domain Number 1 Region: 121-224
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.12e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00006750
Sequence length 358
Comment (Neosartorya fischeri)
Sequence
MPSTYKRDKPWDTDDIDKWKIEEFKPDDNVAGSFAEESSFATLFPKYREQYLKEAWPVVT
RALEKHGIACTLDLVEGSMTVKTTRKTFDPAAILKARDLIKLLSRSVPVQQALKILEDGV
ACDIIKIRNQVRNKERFVKRRQRLLGPSGSTLKALELLTSTYILVQGNTVAAMGPYKGLK
EVRRVVNDCMANIHPIYHIKELMIKRELAKDPTLANESWDRFLPNFKKRTLSKRRVPYKV
TDKSKKVYTPFPPAPEKSKVDLQIESGEYFLSKEAKERAQKEEVMERQRQKREEKMKERA
KSFVPPEELEAEEKKKEKKEKKKRKREAEAEPDDGSEKKEKKKKKKSKSKDASSDGEA
Download sequence
Identical sequences A0A0S7DRR4 A1DH53
36630.CADNFIAP00006750 NFIA_086650||rRNA XP_001260607.1.95823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]