SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00006964 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00006964
Domain Number 1 Region: 135-639
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.12e-163
Family Calponin-homology domain, CH-domain 0.00000000000131
Further Details:      
 
Domain Number 2 Region: 7-90,159-179
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000389
Family Calmodulin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00006964
Sequence length 646
Comment (Neosartorya fischeri)
Sequence
MNVLKLQRKYPHFDQSEIFSLQDAFRKLDVDDKGYLDEATVIKATQQSERQPYDVVRQAL
KEVDLDSSRRVELEDYVDLISRLRSTPAQNRATAGPSAAPGIPEIGMGVSRHVSKGSVGG
RIHVQGSSANVTHTINEDERTEFTRHINAVLAGDPDIGHLLPFPTDTFEMFDKCKDGLVL
AKLINDSVPDTIDERVLNKPGRKIKELNAFHMTENNNIVINSAKGIGCSVVNIGSGDIIE
VREHLILGLIWQIIRRGLLGKIDIKLHPELYRLLEDDETLDQFLRLPPEQILLRWFNYHL
KNAKWDKKVTNFSTDVKNGENYAVLLNQLAPNLCSRAPLETQDLLERAEQVLANSEKLNC
RKFLTPSSLVAGNPKLNLAFVANLFNTIPGLDPITEEEKLEVEDFDAEGEREARVFTLWL
NSLDVQPPVNSLFDDLRDGTILLQAYDKVIPGSVNWRHVNKPPSSGGEMMRFKAVENTNY
AIELGKHIGFSLVGVQGADITDGQRTLTLGLVWQLMRRDITNTLSSLAQRMGKREITDAE
MIRWANDMSRKGGRTSSIRSFKDQTIGTGLFLLDVLNGMKSSYVDYDLVTPGRSDEEAYA
NAKLSISIARKLGATIWLVPEDICQVRSRLVTTFIGSLMATYEKMQ
Download sequence
Identical sequences A1DG59
NFIA_083170||actin-bundling XP_001260263.1.95823 36630.CADNFIAP00006964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]