SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00007587 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00007587
Domain Number 1 Region: 392-463
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.65e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0003
Further Details:      
 
Domain Number 2 Region: 105-183
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000851
Family Eukaryotic type KH-domain (KH-domain type I) 0.00081
Further Details:      
 
Domain Number 3 Region: 191-268
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00007587
Sequence length 464
Comment (Neosartorya fischeri)
Sequence
MSASPSALQSTKRPLEDPSSPSGPNDQPEAKRPALDKVVKGDESEAYTDAKAEPSAAPSA
TADGHGDTVVPDAPNGKGASTETQPIQSTASHGERATSQPEQQRPQDESSWIHIRAVISS
QEAATVIGKGGENVSQIRRLSGAKCTVSDYSRGAVERILTVSGPQDAVAKAFGLIIRTLN
NEPLDAPSTAQSKTYPLRLLIPHLLIGSIIGKGGSRIREIQEASGARLNASDSCLPLSSE
RSLVILGVADSVHIATYYVAVTLVEQLTERFGGPAASAYATRSGGPAGAVPGGMQVVPYV
PQPAGGQYGHPEHFKRHHPHPNRAAAGAYGVPYLHGQPAPAPVAQPALHYGAAPHAPYAG
AGPHQPAPYGAPQPAQARGAPTPATPVGGVMPGQPLTQQIYIPNDMVGAIIGKGGAKINE
IRHLSGSVIKINEPQENSNERLVTITGTQECNQMALYMLYSRLG
Download sequence
Identical sequences A1DFR4
XP_001260118.1.95823 NFIA_081670||KH 36630.CADNFIAP00007587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]