SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00007970 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00007970
Domain Number 1 Region: 571-616
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0055
Further Details:      
 
Domain Number 2 Region: 268-363
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000409
Family Eukaryotic type KH-domain (KH-domain type I) 0.0066
Further Details:      
 
Domain Number 3 Region: 641-725
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Weak hits

Sequence:  36630.CADNFIAP00007970
Domain Number - Region: 501-560
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00007970
Sequence length 1005
Comment (Neosartorya fischeri)
Sequence
MHKISNFTGQARHGWERMTPTFGMSRPHTDMTSHTLRRPHGAPPMTPPTGIDPTVNLSFN
VPFSSTLAGPDIDDVIHASPGALQRWSFPEGTPEGTPVYNLPVHANNVESLRRLCRQITE
SSNGRVEAAVTSSEPKSVPSLQRRPQGLVTNVCITGDGETVRKMRAKILNETPILLRCAT
VDVDIHLIMDGSTKGVRSSVLEHLDTLAAYTGTDIFLLSPKFRDSDSSVVSSYGYASDNG
LDHRFRVSIYGDMESAEHAKTRVLIMIDQILKRHVDAMRLELTMHTLVCGRTRKNIKLIE
AATGTAIYFPPPFPRIFGYTPPGAHRRSEDEVYITGDTQEQIARAKQKLRELVMGVKIYV
KDVIVNSNKIDNILLDRLDKVRKVMEMNGSYVLFPQLGSQRGLVRIQGTEVLHVERTVRE
IMALAGQFYSASWWIIMPDPSQGGFRAPSAADIRTMLSDICTNSGAEVSFDNLTFTINGS
DDAVKSAMMVVNQIPFVKRSQYQMRVKIELANEHKEFVSGKKNGKINKIMGQSNVQIIFD
GFNEYNFYIDVCGNQYESTKNGLDLVEQEMPASISFHVPDQYHKRIIGIGGQHIQRIMKK
YSVFVKFSNAMDRGGMGKEDDDIKVDNVICRTPARNAQSLDLVKQEIMDMVEKVDAEYVS
ERVVINRLYHRELLARMTEIDELEKKWNCKIEFPSTELASDVVTISGPEYQVPQAVDALL
GMVPESHELLFQSSQELRDFFKSPEFREDVCCKLKEQYEVDTSVDANPESPISETGSASS
TFAPEDRVVLGYTRNNAGGLKDAIDFLISRLVAHGLDATTVKGAIPRPKSDSFEESLPFF
DSKLLQHAPTPIVTDSPTRPNFPDETSERGSIFERLRKPGSISSFSSFIGRKNHSASPGS
FFKHASSNASKASLVSMESRDSGYRNPWNDSGVNLPEDDLPVLGSSHSHSNSTNGWPARF
DTKFPFGTAPGDMTPKHDPRASFDSGRPSTSNSTSGYPAPIGPPR
Download sequence
Identical sequences A1DHQ6
NFIA_088690||KH XP_001260810.1.95823 36630.CADNFIAP00007970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]